PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10013510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 241aa    MW: 26839.4 Da    PI: 6.5789
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10013510genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601185.8e-3728125198
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkCa+dC+lap+fp +++k+f n+hklFG+sn+lk+++++ +++r  am++++ eA++ra dPv G++ +il+lq q++ l+a+l+ll 
  Lus10013510  28 ACAACKYQRRKCAPDCPLAPHFPPNHHKEFYNAHKLFGVSNMLKIIRDVTPSNRYLAMKTIIHEANVRALDPVGGCYHMILRLQYQIKFLEAQLDLLL 125
                  7********************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.50927128IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-3528123IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MSHPPPPHKG LLVSSSSSSS SSSSGSQACA ACKYQRRKCA PDCPLAPHFP PNHHKEFYNA  60
HKLFGVSNML KIIRDVTPSN RYLAMKTIIH EANVRALDPV GGCYHMILRL QYQIKFLEAQ  120
LDLLLRQLAF FQSLSPFNDD IPQKEGSQVM GLQSLIDFEQ QDHLQRGKEE EDGVVVEKSC  180
SEPDAYKVFD NMSVKIEMEE SPGQGKASSS QLLKQEEGNS YVVVGDFEQN ERNHIPVGLH  240
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGBra021513.1-P1e-43(Brassica rapa)
STRINGGLYMA08G20550.28e-43(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.18e-37LOB domain-containing protein 22